CacheBy
Atlas Antibodies Anti-CALCOCO1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CALCOCO1 Antibody

상품 한눈에 보기

인간 CALCOCO1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 재조합 발현 검증 완료로 높은 특이성과 신뢰성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038313-100 Anti-CALCOCO1 Antibody, calcium binding and coiled-coil domain 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038313-25 Anti-CALCOCO1 Antibody, calcium binding and coiled-coil domain 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CALCOCO1 Antibody

Anti-CALCOCO1 Antibody

Target: Calcium binding and coiled-coil domain 1 (CALCOCO1)
Type: Polyclonal Antibody against Human CALCOCO1


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Alternative Gene Names

  • calphoglin
  • Cocoa
  • KIAA1536

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHL

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to:

  • Rat ENSRNOG00000048982 (83%)
  • Mouse ENSMUSG00000023055 (82%)

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.