CacheBy
Atlas Antibodies Anti-C8orf58 Antibody
원본

Atlas Antibodies Anti-C8orf58 Antibody

상품 한눈에 보기

Human C8orf58 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제됨. 인간에 특이적이며 쥐, 생쥐와 높은 서열 유사성 보유. 안정적인 PBS/glycerol buffer 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028286-100 Anti-C8orf58 Antibody, chromosome 8 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028286-25 Anti-C8orf58 Antibody, chromosome 8 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf58 Antibody

Anti-C8orf58 Antibody

Target: chromosome 8 open reading frame 58 (C8orf58)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human C8orf58.


Alternative Gene Names

  • FLJ34715

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 8 open reading frame 58
Target Gene C8orf58
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008351 (62%), Mouse ENSMUSG00000044551 (61%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Antigen Sequence

CIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSGVEMAVGDSPLAALPGLSQDSLDFESSGS


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications – IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.