
원본
Atlas Antibodies Anti-C8orf58 Antibody
상품 한눈에 보기
Human C8orf58 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제됨. 인간에 특이적이며 쥐, 생쥐와 높은 서열 유사성 보유. 안정적인 PBS/glycerol buffer 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028286-100 Anti-C8orf58 Antibody, chromosome 8 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028286-25 Anti-C8orf58 Antibody, chromosome 8 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C8orf58 Antibody
Anti-C8orf58 Antibody
Target: chromosome 8 open reading frame 58 (C8orf58)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against human C8orf58.
Alternative Gene Names
- FLJ34715
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 8 open reading frame 58 |
| Target Gene | C8orf58 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000008351 (62%), Mouse ENSMUSG00000044551 (61%) |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
CIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSGVEMAVGDSPLAALPGLSQDSLDFESSGS
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



