CacheBy
Atlas Antibodies Anti-C8orf59 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C8orf59 Antibody

상품 한눈에 보기

Human C8orf59 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성 확보. Human에 반응하며 Mouse와 Rat에서도 높은 서열 유사성. ICC 등 다양한 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044805-100 Anti-C8orf59 Antibody, chromosome 8 open reading frame 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044805-25 Anti-C8orf59 Antibody, chromosome 8 open reading frame 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C8orf59 Antibody

Anti-C8orf59 Antibody

Target: Chromosome 8 open reading frame 59 (C8orf59)
Supplier: Atlas Antibodies


면역세포화학 (ICC)


Product Description

Polyclonal antibody against Human C8orf59

Open Datasheet (PDF)


Target Information

  • Target Protein: Chromosome 8 open reading frame 59
  • Target Gene: C8orf59
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKVLH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000078784 85%
Rat ENSRNOG00000038902 80%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Concentration Notes
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% Added as preservative

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.