CacheBy
Atlas Antibodies Anti-C6orf226 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf226 Antibody

상품 한눈에 보기

인간 C6orf226 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045350-100 Anti-C6orf226 Antibody, chromosome 6 open reading frame 226 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045350-25 Anti-C6orf226 Antibody, chromosome 6 open reading frame 226 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf226 Antibody

Anti-C6orf226 Antibody

Target: chromosome 6 open reading frame 226 (C6orf226)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — validated using recombinant expression
  • Immunocytochemistry (ICC)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C6orf226.


Alternative Gene Names

  • LOC441150

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 6 open reading frame 226
Target Gene C6orf226
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000062619 (55%), Rat ENSRNOG00000046871 (50%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


Antigen Sequence

ASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVG

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.