CacheBy
Atlas Antibodies Anti-C6orf222 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf222 Antibody

상품 한눈에 보기

Human C6orf222 단백질을 인식하는 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. 40% glycerol 및 PBS buffer로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058189-100 Anti-C6orf222 Antibody, chromosome 6 open reading frame 222 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058189-25 Anti-C6orf222 Antibody, chromosome 6 open reading frame 222 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf222 Antibody

Anti-C6orf222 Antibody

Target: chromosome 6 open reading frame 222 (C6orf222)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C6orf222 protein.


Alternative Gene Names

  • DKFZp779B1540

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 222
Target Gene C6orf222
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000048905 (46%), Rat ENSRNOG00000031760 (30%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SFRRAFYHKKHTSKEPRRAGAAGAASPEARRPKRPSFLPLCVGGHRPSTSSSLDPEDLECREPLPAEGEPVVISEAPSQ

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.