CacheBy
Atlas Antibodies Anti-C5orf34 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5orf34 Antibody

상품 한눈에 보기

Human C5orf34 단백질을 인식하는 rabbit polyclonal IgG 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045386-100 Anti-C5orf34 Antibody, chromosome 5 open reading frame 34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045386-25 Anti-C5orf34 Antibody, chromosome 5 open reading frame 34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5orf34 Antibody

Anti-C5orf34 Antibody

Target: Chromosome 5 open reading frame 34 (C5orf34)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human C5orf34.

Alternative Gene Names

FLJ32363

Open Datasheet

Target Information

  • Target Protein: Chromosome 5 open reading frame 34
  • Target Gene: C5orf34

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSPIEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000017581 76%
Mouse ENSMUSG00000062822 74%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지

IHC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.