
원본
Atlas Antibodies Anti-C5orf24 Antibody
상품 한눈에 보기
Human C5orf24 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존도를 보임. PBS/glycerol 완충액에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062502-100 Anti-C5orf24 Antibody, chromosome 5 open reading frame 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062502-25 Anti-C5orf24 Antibody, chromosome 5 open reading frame 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C5orf24 Antibody
Anti-C5orf24 Antibody
Target: chromosome 5 open reading frame 24 (C5orf24)
Type: Polyclonal Antibody against Human C5orf24
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human C5orf24 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- FLJ37562
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 5 open reading frame 24 |
| Target Gene | C5orf24 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRG |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000045767 | 93% |
| Rat | ENSRNOG00000047934 | 86% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



