CacheBy
Atlas Antibodies Anti-C4orf22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4orf22 Antibody

상품 한눈에 보기

인간 C4orf22 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043383-100 Anti-C4orf22 Antibody, chromosome 4 open reading frame 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043383-25 Anti-C4orf22 Antibody, chromosome 4 open reading frame 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4orf22 Antibody

Anti-C4orf22 Antibody

Target: chromosome 4 open reading frame 22 (C4orf22)
Host: Rabbit
Clonality: Polyclonal
Type: Anti-human antibody


  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C4orf22, validated for use in multiple applications.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 4 open reading frame 22
Target Gene C4orf22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLTSAGK
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000057816 (88%), Rat ENSRNOG00000054400 (31%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2); 0.02% sodium azide as preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.