CacheBy
Atlas Antibodies Anti-C4orf3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4orf3 Antibody

상품 한눈에 보기

Human C4orf3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존됩니다. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026907-100 Anti-C4orf3 Antibody, chromosome 4 open reading frame 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026907-25 Anti-C4orf3 Antibody, chromosome 4 open reading frame 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4orf3 Antibody

Anti-C4orf3 Antibody

Target: Chromosome 4 open reading frame 3 (C4orf3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human C4orf3

Open Datasheet


Target Information

항목 내용
Target Protein Chromosome 4 open reading frame 3
Target Gene C4orf3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse: 62% (ENSMUSG00000054091)
Rat: 52% (ENSRNOG00000014654)

Antigen Sequence:
MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.