CacheBy
Atlas Antibodies Anti-C4BPB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4BPB Antibody

상품 한눈에 보기

Human C4BPB 단백질을 인식하는 토끼 폴리클로날 항체로, 보체 성분 결합 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051620-100 Anti-C4BPB Antibody, complement component 4 binding protein, beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051620-25 Anti-C4BPB Antibody, complement component 4 binding protein, beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4BPB Antibody

Anti-C4BPB Antibody

Target: Complement component 4 binding protein, beta (C4BPB)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human C4BPB, targeting complement component 4 binding protein, beta.
Recommended for immunohistochemistry (IHC) and related applications.


Alternative Gene Names

  • C4BP

Open Datasheet


Target Information

항목 내용
Target Protein Complement component 4 binding protein, beta
Target Gene C4BPB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004125 (71%), Mouse ENSMUSG00000026405 (36%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.