CacheBy
Atlas Antibodies Anti-C4BPA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4BPA Antibody

상품 한눈에 보기

인체 C4BPA 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Rabbit에서 생산되었으며 PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성 검증 완료, 신뢰성 높은 단백질 발현 분석에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000926-100 Anti-C4BPA Antibody, complement component 4 binding protein, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000926-25 Anti-C4BPA Antibody, complement component 4 binding protein, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4BPA Antibody

Anti-C4BPA Antibody

Target: Complement component 4 binding protein, alpha
Supplier: Atlas Antibodies


  • IHC (Independent Validation): 단백질 발현을 서로 다른 에피토프를 타깃하는 독립 항체들과 비교하여 검증
  • WB (Western Blot)

Product Description

Polyclonal antibody against human C4BPA.


Alternative Gene Names

  • C4BP

Open Datasheet


Target Information

항목 내용
Target Protein Complement component 4 binding protein, alpha
Target Gene C4BPA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004062 (68%), Mouse ENSMUSG00000026405 (61%)

Antigen Sequence

CDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQST


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.