CacheBy
Atlas Antibodies Anti-C2orf81 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf81 Antibody

상품 한눈에 보기

인체 C2orf81 단백질을 인식하는 토끼 폴리클로날 항체로, RNA-seq 데이터와 비교한 IHC 직교 검증을 통해 단백질 발현을 확인합니다. PrEST 항원으로 친화 정제되었으며, PBS 및 글리세롤 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054835-100 Anti-C2orf81 Antibody, chromosome 2 open reading frame 81 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054835-25 Anti-C2orf81 Antibody, chromosome 2 open reading frame 81 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf81 Antibody

Anti-C2orf81 Antibody

Target: chromosome 2 open reading frame 81 (C2orf81)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C2orf81.


Alternative Gene Names

  • hCG40743
  • LOC388963

Open Datasheet


Specifications

항목 내용
Target Protein chromosome 2 open reading frame 81
Target Gene C2orf81
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030030 (36%), Rat ENSRNOG00000009917 (29%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Antigen Sequence

PGGPVEEADGQSRGLSSAGSLSASFQLSVEEAPADDADPSLDPYLVASPQASTGRGHPLGFHLSLEDLYCCMPQLDAAGDRLELRSEGVPCIASGVLVSYPS

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.