Atlas Antibodies Anti-C2orf76 Antibody

상품 한눈에 보기

Human C2orf76 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 mouse, rat과의 높은 상동성을 보입니다.

카탈로그번호: HPA044977-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044977-100 Anti-C2orf76 Antibody, chromosome 2 open reading frame 76 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044977-25 Anti-C2orf76 Antibody, chromosome 2 open reading frame 76 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C2orf76 Antibody

Anti-C2orf76 Antibody

Target: chromosome 2 open reading frame 76 (C2orf76)
Type: Polyclonal Antibody against Human C2orf76
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Rabbit polyclonal antibody targeting the human C2orf76 protein (chromosome 2 open reading frame 76).
Affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

AIM29, LOC130355, MGC104437

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	chromosome 2 open reading frame 76
Target Gene	C2orf76
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYD
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000026388 (87%), Rat ENSRNOG00000045570 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen as affinity ligand