CacheBy
Atlas Antibodies Anti-POP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POP4 Antibody

상품 한눈에 보기

Human POP4 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 서열 유사성을 보입니다. 안정한 PBS/glycerol 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042748-100 Anti-POP4 Antibody, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042748-25 Anti-POP4 Antibody, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POP4 Antibody

Anti-POP4 Antibody

제품 설명

Human POP4 단백질을 표적으로 하는 Polyclonal Antibody입니다.
processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)

권장 응용 분야

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

대체 유전자명

RPP29

Open Datasheet

표적 정보

항목 내용
Target Protein processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
Target Gene POP4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027646 (93%), Mouse ENSMUSG00000030423 (92%)

Antigen Sequence

KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

버퍼 구성

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

사용상 주의

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.