
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POP4 Antibody
상품 한눈에 보기
Human POP4 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 서열 유사성을 보입니다. 안정한 PBS/glycerol 버퍼에 보존제로 sodium azide가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042748-100 Anti-POP4 Antibody, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042748-25 Anti-POP4 Antibody, processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POP4 Antibody
Anti-POP4 Antibody
제품 설명
Human POP4 단백질을 표적으로 하는 Polyclonal Antibody입니다.
processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
권장 응용 분야
- Immunohistochemistry (IHC)
- Western Blot (WB)
대체 유전자명
RPP29
표적 정보
| 항목 | 내용 |
|---|---|
| Target Protein | processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) |
| Target Gene | POP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000027646 (93%), Mouse ENSMUSG00000030423 (92%) |
Antigen Sequence
KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI
항체 특성
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
버퍼 구성
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
사용상 주의
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



