CacheBy
Atlas Antibodies Anti-PON3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-PON3 Antibody

상품 한눈에 보기

인간 PON3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와 비교한 직교 검증을 통해 단백질 발현 확인에 적합. 프레스트 항원으로 친화 정제되었으며 PBS-글리세롤 버퍼에 보존됨. 다양한 조직 및 세포주에서 신뢰성 있는 단백질 검출에 사용 가능.

브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014848-100 Anti-PON3 Antibody, paraoxonase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014848-25 Anti-PON3 Antibody, paraoxonase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PON3 Antibody

Anti-PON3 Antibody

Target Protein: paraoxonase 3
Supplier: Atlas Antibodies

  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Orthogonal Validation): Orthogonal validation of protein expression using western blot (WB) by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human PON3.

Open Datasheet

Specifications

항목 내용
Target Protein paraoxonase 3
Target Gene PON3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000029759 (83%), Rat ENSRNOG00000009096 (81%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

REVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHP

Safety Information

Material Safety Data Sheet (MSDS)

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-POP4 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PON2 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PON1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-POMP Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.