CacheBy
Atlas Antibodies Anti-POLH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLH Antibody

상품 한눈에 보기

인간 POLH 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. RAD30A, XP-V 유전자 대체명으로도 알려져 있습니다. 40% 글리세롤 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026762-100 Anti-POLH Antibody, polymerase (DNA directed), eta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026762-25 Anti-POLH Antibody, polymerase (DNA directed), eta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLH Antibody

Anti-POLH Antibody

Target Information

  • Target Protein: polymerase (DNA directed), eta
  • Target Gene: POLH
  • Alternative Gene Names: RAD30A, XP-V

Product Description

Polyclonal antibody against human POLH, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000023953 63%
Rat ENSRNOG00000019195 61%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.