CacheBy
Atlas Antibodies Anti-POLG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLG Antibody

상품 한눈에 보기

Human POLG 단백질을 대상으로 한 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 종 간 반응 특이성을 보입니다. PBS/glycerol buffer에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056821-100 Anti-POLG Antibody, polymerase (DNA directed), gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056821-25 Anti-POLG Antibody, polymerase (DNA directed), gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLG Antibody

Anti-POLG Antibody

Target: polymerase (DNA directed), gamma
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human POLG


Alternative Gene Names

  • POLG1
  • POLGA

Open Datasheet


Target Information

항목 내용
Target Protein polymerase (DNA directed), gamma
Target Gene POLG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (93%), Rat (91%)

Antigen Sequence:
FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.