Atlas Antibodies Anti-PMM2 Antibody

상품 한눈에 보기

인간 PMM2 단백질을 표적으로 하는 폴리클로날 항체로, WB 등 단백질 발현 검증에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제됨. 인간, 마우스, 랫트에서 반응성이 확인됨. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040852-100 Anti-PMM2 Antibody, phosphomannomutase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040852-25 Anti-PMM2 Antibody, phosphomannomutase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: phosphomannomutase 2
Supplier: Atlas Antibodies

Validation of protein expression in Western Blot (WB) by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human PMM2.

CDG1, CDG1a, CDGS, PMI, PMI1

항목	내용
Target Protein	phosphomannomutase 2
Target Gene	PMM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000002615 (88%), Mouse ENSMUSG00000022711 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.

WDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.