CacheBy
Atlas Antibodies Anti-PMF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PMF1 Antibody

상품 한눈에 보기

Human PMF1 단백질을 인식하는 Rabbit Polyclonal 항체로, polyamine-modulated factor 1 연구에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. ICC 등 다양한 응용 가능. 40% glycerol 기반 buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034583-100 Anti-PMF1 Antibody, polyamine-modulated factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034583-25 Anti-PMF1 Antibody, polyamine-modulated factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PMF1 Antibody

Anti-PMF1 Antibody

Target: polyamine-modulated factor 1 (PMF1)
Type: Polyclonal Antibody against Human PMF1

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human polyamine-modulated factor 1 (PMF1).
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet

Target Information

항목 내용
Target Protein polyamine-modulated factor 1
Target Gene PMF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019620 (59%), Mouse ENSMUSG00000028066 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

ICC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.