CacheBy
Atlas Antibodies Anti-PLPPR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLPPR3 Antibody

상품 한눈에 보기

사람 PLPPR3 단백질을 인식하는 토끼 폴리클로날 항체로, 인체 시료 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052293-100 Anti-PLPPR3 Antibody, phospholipid phosphatase related 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052293-25 Anti-PLPPR3 Antibody, phospholipid phosphatase related 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLPPR3 Antibody

Anti-PLPPR3 Antibody

Target: phospholipid phosphatase related 3 (PLPPR3)
Supplier: Atlas Antibodies


본 항체는 인체 유래 시료 분석(IHC 등)에 권장됩니다.


Product Description

Polyclonal antibody against human PLPPR3 protein.


Alternative Gene Names

FLJ11535, LPPR3, PRG-2, PRG2

Open Datasheet


Target Information

항목 내용
Target Protein phospholipid phosphatase related 3
Target Gene PLPPR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000042002 (35%), Rat ENSRNOG00000011752 (33%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.