CacheBy
Atlas Antibodies Anti-PLPP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLPP6 Antibody

상품 한눈에 보기

Human PLPP6 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. WB, IHC, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증된 반응성, 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018096-100 Anti-PLPP6 Antibody, phospholipid phosphatase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018096-25 Anti-PLPP6 Antibody, phospholipid phosphatase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLPP6 Antibody

Anti-PLPP6 Antibody

Target: phospholipid phosphatase 6 (PLPP6)
Type: Polyclonal Antibody against Human PLPP6


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody generated in rabbit against human PLPP6 protein.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

FLJ46512, FLJ90191, PDP1, PPAPDC2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR


Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000015268 94%
Mouse ENSMUSG00000040105 88%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.