
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLPP7 Antibody
상품 한눈에 보기
Human PLPP7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070252-100 Anti-PLPP7 Antibody, phospholipid phosphatase 7 (inactive) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070252-25 Anti-PLPP7 Antibody, phospholipid phosphatase 7 (inactive) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLPP7 Antibody
Anti-PLPP7 Antibody
Target: phospholipid phosphatase 7 (inactive)
Type: Polyclonal Antibody against Human PLPP7
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human PLPP7.
Alternative gene names include C9orf67, FLJ14662, MGC12921, NET39, PPAPDC3.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipid phosphatase 7 (inactive) |
| Target Gene | PLPP7 |
| Antigen Sequence | GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000051373 (97%), Rat ENSRNOG00000010068 (97%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



