CacheBy
Atlas Antibodies Anti-PLPP7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLPP7 Antibody

상품 한눈에 보기

Human PLPP7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070252-100 Anti-PLPP7 Antibody, phospholipid phosphatase 7 (inactive) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070252-25 Anti-PLPP7 Antibody, phospholipid phosphatase 7 (inactive) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLPP7 Antibody

Anti-PLPP7 Antibody

Target: phospholipid phosphatase 7 (inactive)
Type: Polyclonal Antibody against Human PLPP7


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human PLPP7.
Alternative gene names include C9orf67, FLJ14662, MGC12921, NET39, PPAPDC3.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phospholipid phosphatase 7 (inactive)
Target Gene PLPP7
Antigen Sequence GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000051373 (97%), Rat ENSRNOG00000010068 (97%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.