CacheBy
Atlas Antibodies Anti-PLPP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLPP3 Antibody

상품 한눈에 보기

인간 PLPP3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 적합합니다. LPP3, PAP-2b, PPAP2B 유전자와 관련된 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072751-100 Anti-PLPP3 Antibody, phospholipid phosphatase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072751-25 Anti-PLPP3 Antibody, phospholipid phosphatase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLPP3 Antibody

Anti-PLPP3 Antibody

Target Protein: phospholipid phosphatase 3 (PLPP3)
Type: Polyclonal Antibody against Human PLPP3


  • Immunohistochemistry (IHC)
  • Other validated applications may apply

phospholipid phosphatase 3


Product Description

Polyclonal antibody raised in rabbit against human PLPP3.


Alternative Gene Names

  • LPP3
  • PAP-2b
  • PPAP2B

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028517): 96%
  • Rat (ENSRNOG00000008116): 96%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.