CacheBy
Atlas Antibodies Anti-PIGX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PIGX Antibody

상품 한눈에 보기

인간 PIGX 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조. 재조합 발현 검증 완료. 고품질의 신뢰성 있는 연구용 항체.

카탈로그번호
HPA073301-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073301-100 Anti-PIGX Antibody, phosphatidylinositol glycan anchor biosynthesis class X 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073301-25 Anti-PIGX Antibody, phosphatidylinositol glycan anchor biosynthesis class X 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIGX Antibody

Anti-PIGX Antibody

Target: phosphatidylinositol glycan anchor biosynthesis, class X
Type: Polyclonal Antibody against Human PIGX
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

This is a polyclonal antibody raised in rabbit against human PIGX protein. It has been affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • FLJ20522

Target Information

항목 내용
Target Protein phosphatidylinositol glycan anchor biosynthesis, class X
Target Gene PIGX
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000023791 (84%)
Rat ENSRNOG00000033623 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Documents


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.