Atlas Antibodies Anti-PIGU Antibody

상품 한눈에 보기

Human PIGU 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보임. 40% 글리세롤 및 PBS 완충액에 보존제로 나트륨 아자이드 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046766-100 Anti-PIGU Antibody, phosphatidylinositol glycan anchor biosynthesis, class U 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046766-25 Anti-PIGU Antibody, phosphatidylinositol glycan anchor biosynthesis, class U 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human PIGU.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINN

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide
MSDS	Material Safety Data Sheet