Atlas Antibodies Anti-PHKG2 Antibody

상품 한눈에 보기

Human PHKG2 단백질을 표적으로 하는 고품질 폴리클로날 항체. WB 및 ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA068751-100 Anti-PHKG2 Antibody, phosphorylase kinase, gamma 2 (testis) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA068751-25 Anti-PHKG2 Antibody, phosphorylase kinase, gamma 2 (testis) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phosphorylase kinase, gamma 2 (testis)
Supplier: Atlas Antibodies

Western Blot (WB) — Independent validation by comparing antibodies targeting different epitopes of the same protein
Immunocytochemistry (ICC)

Polyclonal antibody against human PHKG2.

항목	내용
Target Protein	phosphorylase kinase, gamma 2 (testis)
Target Gene	PHKG2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (94%), Rat (92%)

Antigen Sequence:

LTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLY

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand