CacheBy
Atlas Antibodies Anti-PHKG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHKG1 Antibody

상품 한눈에 보기

Human PHKG1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PHKG1의 orthogonal validation 완료. PrEST 항원을 이용해 친화정제되었으며, 고순도와 재현성을 보장. Human에 특이적으로 반응함.

카탈로그번호
HPA012057-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012057-100 Anti-PHKG1 Antibody, phosphorylase kinase, gamma 1 (muscle) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012057-25 Anti-PHKG1 Antibody, phosphorylase kinase, gamma 1 (muscle) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHKG1 Antibody

Anti-PHKG1 Antibody

Target: phosphorylase kinase, gamma 1 (muscle)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human PHKG1.


Alternative Gene Names

PHKG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phosphorylase kinase, gamma 1 (muscle)
Target Gene PHKG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMR
Verified Species Reactivity Human
Interspecies Identity Mouse (93%), Rat (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.