AI 생성

1 / 2

Atlas Antibodies Anti-PEX5 Antibody

상품 한눈에 보기

Human PEX5 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. Human과 Mouse에 대한 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039259-100 Anti-PEX5 Antibody, peroxisomal biogenesis factor 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039259-25 Anti-PEX5 Antibody, peroxisomal biogenesis factor 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Peroxisomal biogenesis factor 5 (PEX5)
Supplier: Atlas Antibodies

IHC (Independent validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent validation): Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human PEX5.

PTS1R, PXR1

항목	내용
Target Protein	Peroxisomal biogenesis factor 5
Target Gene	PEX5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Identity	Rat (93%), Mouse (91%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand

DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Validation
WB Validation
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.