Atlas Antibodies Anti-PEX5 Antibody

상품 한눈에 보기

Human PEX5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 사용 가능. PrEST 항원을 이용해 친화정제되었으며, 사람과 마우스 반응성이 검증됨. 세포 내 퍼옥시좀 생합성 인자 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039260-100 Anti-PEX5 Antibody, peroxisomal biogenesis factor 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039260-25 Anti-PEX5 Antibody, peroxisomal biogenesis factor 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Peroxisomal biogenesis factor 5 (PEX5)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human PEX5.

PTS1R, PXR1

항목	내용
Target Protein	Peroxisomal biogenesis factor 5
Target Gene	PEX5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Verified Species Reactivity	Human, Mouse
Interspecies Information	Rat ENSRNOG00000010407 (93%), Mouse ENSMUSG00000005069 (91%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand