
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PEX2 Antibody
상품 한눈에 보기
Human PEX2 단백질을 인식하는 토끼 폴리클로날 항체로, peroxisomal biogenesis factor 2 연구에 사용됩니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027729-100 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027729-25 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PEX2 Antibody
Anti-PEX2 Antibody
Target: Peroxisomal biogenesis factor 2 (PEX2)
Type: Polyclonal Antibody against Human PEX2
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal antibody raised in rabbit against human PEX2 (peroxisomal biogenesis factor 2).
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
PAF-1, PMP35, PXMP3, RNF72, ZWS3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Peroxisomal biogenesis factor 2 |
| Target Gene | PEX2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040374 (90%)
- Rat ENSRNOG00000008748 (90%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



