CacheBy
Atlas Antibodies Anti-PEX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PEX2 Antibody

상품 한눈에 보기

Human PEX2 단백질을 인식하는 토끼 폴리클로날 항체로, 퍼옥시좀 생합성 인자 연구용. IHC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조됨. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011410-100 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011410-25 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PEX2 Antibody

Anti-PEX2 Antibody

Target: Peroxisomal biogenesis factor 2 (PEX2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human PEX2 protein, designed for research use.
Recommended for applications such as immunohistochemistry (IHC).

Recommended Applications: Immunohistochemistry (IHC)


Alternative Gene Names

PAF-1, PMP35, PXMP3, RNF72, ZWS3

Open Datasheet


Antigen Information

Antigen Sequence (Recombinant PrEST):

NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000040374): 90%
  • Rat (ENSRNOG00000008748): 90%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.