Atlas Antibodies Anti-PEX2 Antibody

상품 한눈에 보기

Human PEX2 단백질을 인식하는 토끼 폴리클로날 항체로, 퍼옥시좀 생합성 인자 연구용. IHC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조됨. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011410-100 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011410-25 Anti-PEX2 Antibody, peroxisomal biogenesis factor 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Peroxisomal biogenesis factor 2 (PEX2)
Supplier: Atlas Antibodies

Polyclonal antibody against human PEX2 protein, designed for research use.
Recommended for applications such as immunohistochemistry (IHC).

Recommended Applications: Immunohistochemistry (IHC)

PAF-1, PMP35, PXMP3, RNF72, ZWS3

Antigen Sequence (Recombinant PrEST):

NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.