CacheBy
Atlas Antibodies Anti-PELP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PELP1 Antibody

상품 한눈에 보기

Human PELP1 단백질을 인식하는 토끼 폴리클로날 항체로, Affinity 정제 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 고순도의 IgG 형태로 PBS/glycerol buffer에 보존됩니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA053966-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053966-100 Anti-PELP1 Antibody, proline, glutamate and leucine rich protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053966-25 Anti-PELP1 Antibody, proline, glutamate and leucine rich protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PELP1 Antibody

Anti-PELP1 Antibody

Target: proline, glutamate and leucine rich protein 1 (PELP1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PELP1.


Alternative Gene Names

  • MNAR

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proline, glutamate and leucine rich protein 1
Target Gene PELP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000018921 (96%), Rat ENSRNOG00000019268 (94%)

Antigen Sequence:

GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.