Atlas Antibodies Anti-PELI3 Antibody

상품 한눈에 보기

휴먼 PELI3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되었으며, 다양한 응용 분야에 적합. Human에 반응하며, 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062281-100 Anti-PELI3 Antibody, pellino E3 ubiquitin protein ligase family member 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062281-25 Anti-PELI3 Antibody, pellino E3 ubiquitin protein ligase family member 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: pellino E3 ubiquitin protein ligase family member 3

Polyclonal antibody against Human PELI3.

Target Protein: pellino E3 ubiquitin protein ligase family member 3
Target Gene: PELI3
Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKY
```

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand