
원본
Thermo Fisher Scientific FLT3LG Polyclonal Antibody
상품 한눈에 보기
FLT3LG 단백항체로 인간 및 랫드 시료에 반응. Western blot에 적합하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도. 수지상세포 발달 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 08:50
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579272 FLT3LG Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific FLT3LG Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3 ligand (79–110 aa, AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746388 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FLT3LG (Fms Related Tyrosine Kinase 3 Ligand)은 단백질 코딩 유전자로, 조혈줄기세포 분화 및 Ras 신호전달 경로와 관련되어 있습니다. FLT3LG는 수지상세포(DC)의 발달을 조절하며, 특히 형질세포형 DC와 CD8 양성 고전적 DC 및 그들의 CD103 양성 조직 대응체에 중요합니다. 관련 질환으로는 재생불량성 빈혈(Aplastic Anemia)과 뇌암(Brain Cancer)이 보고되어 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
