CacheBy
Atlas Antibodies Anti-C21orf62 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C21orf62 Antibody

상품 한눈에 보기

Human C21orf62 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고순도 제품. 다양한 조직에서 단백질 발현 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016899-100 Anti-C21orf62 Antibody, chromosome 21 open reading frame 62 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016899-25 Anti-C21orf62 Antibody, chromosome 21 open reading frame 62 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C21orf62 Antibody

Anti-C21orf62 Antibody

chromosome 21 open reading frame 62


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human C21orf62


Alternative Gene Names

B37, C21orf120, PRED81

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 21 open reading frame 62
Target Gene C21orf62
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMYISFLD
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000028670 (64%), Mouse ENSMUSG00000039851 (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.