CacheBy
Atlas Antibodies Anti-C21orf33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-C21orf33 Antibody

상품 한눈에 보기

Human C21orf33 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 인체 반응성이 검증되었습니다. 40% glycerol/PBS 버퍼에 sodium azide 보존제가 포함되어 있습니다.

카탈로그번호
HPA018517-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018517-100 Anti-C21orf33 Antibody, chromosome 21 open reading frame 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018517-25 Anti-C21orf33 Antibody, chromosome 21 open reading frame 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C21orf33 Antibody

Anti-C21orf33 Antibody

Target: chromosome 21 open reading frame 33
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C21orf33.

Alternative Gene Names

D21S2048E, ES1, GT335, HES1, KNP-I, KNP-Ia, KNPH, KNPI

Open Datasheet

Target Information

  • Target Protein: chromosome 21 open reading frame 33
  • Target Gene: C21orf33
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053329 90%
Rat ENSRNOG00000001211 88%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-C21orf91 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C21orf62 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C21orf58 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-C21orf58 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.