CacheBy
Atlas Antibodies Anti-C18orf25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C18orf25 Antibody

상품 한눈에 보기

Human C18orf25 단백질을 인식하는 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성 보유. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA065021-100 Anti-C18orf25 Antibody, chromosome 18 open reading frame 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065021-25 Anti-C18orf25 Antibody, chromosome 18 open reading frame 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C18orf25 Antibody

Anti-C18orf25 Antibody

Target: chromosome 18 open reading frame 25 (C18orf25)
Supplier: Atlas Antibodies

면역조직화학(IHC)

Product Description

Polyclonal antibody against human C18orf25.

Alternative Gene Names

ARKL1, MGC12909, RNF111L1

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 18 open reading frame 25
Target Gene C18orf25
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000047466 (97%), Rat ENSRNOG00000061540 (95%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.