CacheBy
Atlas Antibodies Anti-C18orf21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C18orf21 Antibody

상품 한눈에 보기

인간 C18orf21 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 반응성 검증 완료. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA067322-100 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067322-25 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C18orf21 Antibody

Anti-C18orf21 Antibody

Target: chromosome 18 open reading frame 21 (C18orf21)
Type: Polyclonal antibody against Human C18orf21

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C18orf21 protein.

Alternative Gene Names

HsT3108, PNAS-124, PNAS-131

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 18 open reading frame 21
Target Gene C18orf21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLL

Verified Species Reactivity

  • Human

Interspecies Information

종 유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000024273 65%
Rat ENSRNOG00000015546 63%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.