Atlas Antibodies Anti-C12orf43 Antibody

상품 한눈에 보기

인간 C12orf43 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 실험에 적합하며 재조합 발현 검증을 거쳤습니다. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061739-100 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061739-25 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 12 open reading frame 43 (C12orf43)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, recombinant expression validation using target protein overexpression)
ICC (Immunocytochemistry)

Polyclonal antibody against human C12orf43.
Validated for use in multiple assays with recombinant expression verification.

항목	내용
Target Protein	chromosome 12 open reading frame 43
Target Gene	C12orf43
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000029559 (69%), Rat ENSRNOG00000001185 (58%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet