
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf43 Antibody
상품 한눈에 보기
인간 C12orf43 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 실험에 적합하며 재조합 발현 검증을 거쳤습니다. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA061739-100 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061739-25 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf43 Antibody
Anti-C12orf43 Antibody
Target: chromosome 12 open reading frame 43 (C12orf43)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation using target protein overexpression)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human C12orf43.
Validated for use in multiple assays with recombinant expression verification.
Alternative Gene Names
- FLJ12448
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 43 |
| Target Gene | C12orf43 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000029559 (69%), Rat ENSRNOG00000001185 (58%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



