AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf56 Antibody
상품 한눈에 보기
인체 C12orf56 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반의 오쏘고날 검증을 통해 신뢰성 확보. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 버퍼에 보존제로 sodium azide 함유.
- 카탈로그번호
- HPA056986-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056986-100 Anti-C12orf56 Antibody, chromosome 12 open reading frame 56 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056986-25 Anti-C12orf56 Antibody, chromosome 12 open reading frame 56 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf56 Antibody
Anti-C12orf56 Antibody
Target: chromosome 12 open reading frame 56 (C12orf56)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human C12orf56.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 56 |
| Target Gene | C12orf56 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000047642 (51%), Rat ENSRNOG00000023824 (50%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Antigen Sequence
RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.