CacheBy
Atlas Antibodies Anti-BMP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BMP2 Antibody

상품 한눈에 보기

인간 BMP2 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC 응용에 적합하며 PrEST 항원으로 친화 정제됨. 높은 종간 보존성을 가지며, 40% 글리세롤 PBS 버퍼에 보존제 포함.

카탈로그번호
HPA058610-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058610-100 Anti-BMP2 Antibody, bone morphogenetic protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058610-25 Anti-BMP2 Antibody, bone morphogenetic protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BMP2 Antibody

Anti-BMP2 Antibody

Target Information

  • Target Protein: Bone morphogenetic protein 2
  • Target Gene: BMP2
  • Alternative Gene Name: BMP2A

Product Description

Polyclonal antibody against human BMP2.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000021276 91%
Mouse ENSMUSG00000027358 89%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.