
원본
Atlas Antibodies Anti-BMP4 Antibody
상품 한눈에 보기
인간 BMP4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 40% 글리세롤 및 PBS 버퍼에 안정화. BMP4 유전자 및 단백질 연구용으로 권장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA066235-100 Anti-BMP4 Antibody, bone morphogenetic protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066235-25 Anti-BMP4 Antibody, bone morphogenetic protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BMP4 Antibody
Anti-BMP4 Antibody
Target Information
- Target Protein: Bone Morphogenetic Protein 4
- Target Gene: BMP4
- Alternative Gene Name: BMP2B
Product Description
Polyclonal antibody against human BMP4.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPELP
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000021835): 94%
- Rat (ENSRNOG00000009694): 94%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
- Immunohistochemistry (IHC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



