CacheBy
Atlas Antibodies Anti-BMP4 Antibody
원본

Atlas Antibodies Anti-BMP4 Antibody

상품 한눈에 보기

인간 BMP4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 40% 글리세롤 및 PBS 버퍼에 안정화. BMP4 유전자 및 단백질 연구용으로 권장.

카탈로그번호
HPA066235-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066235-100 Anti-BMP4 Antibody, bone morphogenetic protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066235-25 Anti-BMP4 Antibody, bone morphogenetic protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BMP4 Antibody

Anti-BMP4 Antibody

Target Information

  • Target Protein: Bone Morphogenetic Protein 4
  • Target Gene: BMP4
  • Alternative Gene Name: BMP2B

Product Description

Polyclonal antibody against human BMP4.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPELP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000021835): 94%
  • Rat (ENSRNOG00000009694): 94%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.