CacheBy
Atlas Antibodies Anti-PCNX3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCNX3 Antibody

상품 한눈에 보기

Human PCNX3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. FLJ22427, PCNXL3 유전자 대체명 포함. 고순도의 Affinity Purified 제품으로 40% glycerol 기반 PBS buffer에 보존됨.

카탈로그번호
HPA018084-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018084-100 Anti-PCNX3 Antibody, pecanex homolog 3 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018084-25 Anti-PCNX3 Antibody, pecanex homolog 3 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCNX3 Antibody

Anti-PCNX3 Antibody

Target: pecanex homolog 3 (Drosophila)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human PCNX3.


Alternative Gene Names

FLJ22427, PCNXL3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein pecanex homolog 3 (Drosophila)
Target Gene PCNX3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPLLKGSLSQELSKSFLTLTRPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDSCFS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000020742 (89%)
  • Mouse ENSMUSG00000054874 (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.