CacheBy
Atlas Antibodies Anti-PCNX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCNX2 Antibody

상품 한눈에 보기

Human PCNX2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, PBS-글리세롤 버퍼에 보존됨.

카탈로그번호
HPA013815-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013815-100 Anti-PCNX2 Antibody, pecanex homolog 2 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013815-25 Anti-PCNX2 Antibody, pecanex homolog 2 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCNX2 Antibody

Anti-PCNX2 Antibody

Target: pecanex homolog 2 (Drosophila)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human PCNX2.


Alternative Gene Names

FLJ11383, KIAA0435, PCNXL2

Open Datasheet


Target Information

항목 내용
Target Protein pecanex homolog 2 (Drosophila)
Target Gene PCNX2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000028580 (65%), Mouse ENSMUSG00000060212 (61%)

Antigen Sequence:
SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.