CacheBy
Atlas Antibodies Anti-PBK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PBK Antibody

상품 한눈에 보기

인간 PBK(PDZ binding kinase)를 타깃으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit host 기반 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 및 마우스 반응성이 검증되었으며, 안정한 PBS/glycerol buffer에 보존됩니다.

카탈로그번호
HPA050656-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050656-100 Anti-PBK Antibody, PDZ binding kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050656-25 Anti-PBK Antibody, PDZ binding kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PBK Antibody

Anti-PBK Antibody

Target Protein: PDZ binding kinase
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PBK.


Alternative Gene Names

CT84, FLJ14385, Nori-3, SPK, TOPK

Open Datasheet


Specifications

항목 내용
Target Protein PDZ binding kinase
Target Gene PBK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse
Interspecies Information Rat ENSRNOG00000015308 (94%), Mouse ENSMUSG00000022033 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

SSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRP

Safety Information

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.