Atlas Antibodies Anti-PBOV1 Antibody

상품 한눈에 보기

Human PBOV1 단백질을 인식하는 토끼 유래 폴리클로날 항체. 전립선 및 유방암 과발현 단백질 연구용으로 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. IHC 등 다양한 응용 분야에 사용 가능. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.

카탈로그번호: HPA063021-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063021-100 Anti-PBOV1 Antibody, prostate and breast cancer overexpressed 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063021-25 Anti-PBOV1 Antibody, prostate and breast cancer overexpressed 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PBOV1 Antibody

Anti-PBOV1 Antibody

prostate and breast cancer overexpressed 1

Recommended Applications

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human PBOV1

Alternative Gene Names

UC28, UROC28

Open Datasheet

Target Information

Target Protein: prostate and breast cancer overexpressed 1
Target Gene: PBOV1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000036097	25%
Rat	ENSRNOG00000016146	23%

Antibody Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand