Atlas Antibodies Anti-PADI1 Antibody

상품 한눈에 보기

Human PADI1 단백질을 인식하는 고품질 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 완료. Affinity purification으로 높은 특이성과 재현성 보장. 인체 시료 분석에 신뢰성 있는 결과 제공.

카탈로그번호: HPA062294-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062294-100 Anti-PADI1 Antibody, peptidyl arginine deiminase, type I 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062294-25 Anti-PADI1 Antibody, peptidyl arginine deiminase, type I 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PADI1 Antibody

Anti-PADI1 Antibody

Target Protein: peptidyl arginine deiminase, type I
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human PADI1

Alternative Gene Names

HPAD10, PAD1, PDI, PDI1

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Peptidyl arginine deiminase, type I
Target Gene	PADI1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000025329 (82%) Rat ENSRNOG00000007067 (82%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.