CacheBy
Atlas Antibodies Anti-PADI3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PADI3 Antibody

상품 한눈에 보기

Human PADI3 단백질을 표적으로 하는 폴리클로날 토끼 항체로 WB 및 ICC에 적합. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Human 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043739-100 Anti-PADI3 Antibody, peptidyl arginine deiminase, type III 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043739-25 Anti-PADI3 Antibody, peptidyl arginine deiminase, type III 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PADI3 Antibody

Anti-PADI3 Antibody

Target: peptidyl arginine deiminase, type III (PADI3)
Supplier: Atlas Antibodies


  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PADI3


Alternative Gene Names

  • PDI3

Target Information

항목 내용
Target Protein peptidyl arginine deiminase, type III
Target Gene PADI3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000006950 (80%), Mouse ENSMUSG00000025328 (75%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents


제품 이미지

Enhanced Validation
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.