
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PADI3 Antibody
상품 한눈에 보기
Human PADI3 단백질을 표적으로 하는 폴리클로날 토끼 항체로 WB 및 ICC에 적합. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Human 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA043739-100 Anti-PADI3 Antibody, peptidyl arginine deiminase, type III 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043739-25 Anti-PADI3 Antibody, peptidyl arginine deiminase, type III 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PADI3 Antibody
Anti-PADI3 Antibody
Target: peptidyl arginine deiminase, type III (PADI3)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PADI3
Alternative Gene Names
- PDI3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | peptidyl arginine deiminase, type III |
| Target Gene | PADI3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000006950 (80%), Mouse ENSMUSG00000025328 (75%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREVNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



