CacheBy
Atlas Antibodies Anti-OVGP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OVGP1 Antibody

상품 한눈에 보기

인체 OVGP1 단백질을 인식하는 폴리클로날 항체로, 다양한 면역학적 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 사용 전 부드럽게 혼합 후 적용을 권장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031666-100 Anti-OVGP1 Antibody, oviductal glycoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031666-25 Anti-OVGP1 Antibody, oviductal glycoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OVGP1 Antibody

Anti-OVGP1 Antibody

Target Information

  • Target Protein: Oviductal glycoprotein 1
  • Target Gene: OVGP1
  • Alternative Gene Names: CHIT5, MUC9

Product Description

Polyclonal antibody against human OVGP1.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPER

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000074340 68%
Rat ENSRNOG00000033162 33%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.