CacheBy
Atlas Antibodies Anti-OVCH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OVCH1 Antibody

상품 한눈에 보기

Human OVCH1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤/PBS 완충액에 보존되며, 인간 시료에서 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040253-100 Anti-OVCH1 Antibody, ovochymase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040253-25 Anti-OVCH1 Antibody, ovochymase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OVCH1 Antibody

Anti-OVCH1 Antibody

Target Information

  • Target Protein: ovochymase 1
  • Target Gene: OVCH1
  • Alternative Gene Names: OVCH

Product Description

Polyclonal antibody against human OVCH1 (ovochymase 1).
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence

NCIYDAVVIYGDSEEKHKLAKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDVCGIPPFSPQWL
  • Immunohistochemistry (IHC)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000029047 (29%)
  • Mouse ENSMUSG00000028979 (25%)

Specifications

항목 내용
Clonality Polyclonal
Host Rabbit
Isotype IgG
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Storage Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.